PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT28549
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 736aa    MW: 81358.9 Da    PI: 7.1274
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT28549genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.89.4e-175195147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+eE+e++++a k++G   W+ I +++g ++t+ q++s+ qk+
         EMT28549 51 REKWTEEEHEKFLEALKLYGRS-WRQIQEHIG-TKTAVQIRSHAQKF 95
                     789*****************55.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.24E-154599IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-104597IPR009057Homeodomain-like
PROSITE profilePS5129422.2446100IPR017930Myb domain
TIGRFAMsTIGR015571.4E-154998IPR006447Myb domain, plants
SMARTSM007171.6E-145098IPR001005SANT/Myb domain
PfamPF002492.3E-145194IPR001005SANT/Myb domain
CDDcd001672.99E-115396No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009845Biological Processseed germination
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 736 aa     Download sequence    Send to blast
MALAEERDAL DSSRMPIGTG LSVDVAMEPN EEGMGEHPVK PRKPYTSTKQ REKWTEEEHE  60
KFLEALKLYG RSWRQIQEHI GTKTAVQIRS HAQKFFSKVV REPGAKIEIE IPPPRPKRKP  120
LHPYPRKRAN SCNGANAANG QSKLAHMSSS SGSDQENGSP VSVISAMQSD AFGSSMSNPS  180
SRSASPESSD EENIVLPMVN GGEGQQTGID QSHKEADQEN KDTGTSEEDS SDEVQVTSVK  240
LFGKTVVIPD PRKRCSPDTG SGHENGEQTS ESSNKGTSQA PLAVDIPTHT KGEQISQSSN  300
KATSQAPLAV EVPTYTNGEQ ISEFSYMATS QAPLAVEIQA YAAPPSGWVL PYNSFPLHFG  360
ESAEARIARL HMWWPYYGFP MVHPSGPSAV AHNGKATDES EAAKSPPVES SSDFVDNTQA  420
TASKQWKVLE SLGTAQAPPS VSNFQLKPST NSAFVRVKPI ISSGDEPEEP VPHIPLLRYI  480
LRFYLHIEIG GGLAREMRVV SCLRPVKSRA QVVADANMSC EEPKWKWIAE GFIATKRAHD  540
MVLDLIISLS DEENFATVLN RVCNPLPNKN HRLSLQSCGF KHKWAIHTIT GSKLHIRSWN  600
VFGETKRIPP LVDSQSLRVF DICVRKLSSS IALLLKLVRL FIDQDTVFPG DMFGRMQALE  660
EVSDICKVDK PEKFLEGLGH LTRLRKILMG ELLNCPDEDK CVLRYNGEKL ESSLNELGKH  720
NRRYLPSHRK MGKIFV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519420.0JF951942.1 Triticum aestivum clone TaMYB59 MYB-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563237.10.0PREDICTED: protein REVEILLE 1-like isoform X1
TrEMBLM8C2S50.0M8C2S5_AEGTA; Myb-like protein G
STRINGMLOC_57684.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77833647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G37260.18e-33MYB_related family protein